PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00089g01411.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 294aa    MW: 33517.2 Da    PI: 4.8827
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00089g01411.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.77.5e-151457146
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                              +g W++eEde+l ++++++G g+W+++++  g  Rt++++k++w++
  Peaxi162Scf00089g01411.1 14 KGLWSPEEDEKLCNYITKFGVGSWSSVPKLAG--RTDNEIKNFWNS 57
                              678****************************8..**********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-20667IPR009057Homeodomain-like
SuperFamilySSF466897.03E-15869IPR009057Homeodomain-like
PROSITE profilePS5129421.821963IPR017930Myb domain
SMARTSM007178.5E-121361IPR001005SANT/Myb domain
PfamPF002492.2E-121457IPR001005SANT/Myb domain
CDDcd001672.39E-101759No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MGRHACCVKQ KLRKGLWSPE EDEKLCNYIT KFGVGSWSSV PKLAGRTDNE IKNFWNSSLK  60
KKLMKQGIDP NTHMPLSENT QVRDEENCTD KTSMLQMPHL NGLPSAEMDQ TFHTTNRSFN  120
TEAKNGHLTE ASKEDQFVSK QVFDIMFLHG YQSNVNPSAY DSEVLAQYQQ IIRSYDHPSE  180
FEENPNYGIC SETSLTKFEH GQTTETDFAS SSSNSSNICG YQNNATRIRT NGMLEINETL  240
SWDVENKMES IFQYPYIEIK NEELKQRPGD FSNCPLSCLT EELCGANLDV IQQI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754426e-41HG975442.1 Solanum pennellii chromosome ch03, complete genome.
GenBankHG9755156e-41HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016487611.11e-132PREDICTED: transcription factor MYB32-like
TrEMBLM1BJE11e-101M1BJE1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000466451e-100(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26660.11e-31myb domain protein 86